PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P17190_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 230aa    MW: 26426.1 Da    PI: 5.7143
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P17190_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.3e-181663148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT +Ed+ll++ v+++G g+W+++++  g++R++k+c++rw +yl
  GSMUA_Achr11P17190_001 16 KGPWTVQEDQLLIEHVTLHGEGQWNSVSKLSGLRRSGKSCRLRWVNYL 63
                            79********************************************97 PP

2Myb_DNA-binding48.42.2e-1569113147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             rg+ T++E+  + ++++++G++ W++Iar ++ gRt++++k++w+++
  GSMUA_Achr11P17190_001  69 RGSITPQEENTIQELHALWGNR-WSAIARSLP-GRTDNEIKNYWRTH 113
                             7889******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.9341167IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-211366IPR009057Homeodomain-like
SuperFamilySSF466894.12E-2914110IPR009057Homeodomain-like
SMARTSM007174.3E-151565IPR001005SANT/Myb domain
PfamPF002491.9E-161663IPR001005SANT/Myb domain
CDDcd001673.38E-101863No hitNo description
Gene3DG3DSA:1.10.10.607.8E-2467116IPR009057Homeodomain-like
SMARTSM007174.7E-1568116IPR001005SANT/Myb domain
PROSITE profilePS5129417.33168118IPR017930Myb domain
PfamPF002493.4E-1469113IPR001005SANT/Myb domain
CDDcd001671.18E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDGQLGWGTT EDGWRKGPWT VQEDQLLIEH VTLHGEGQWN SVSKLSGLRR SGKSCRLRWV  60
NYLRPDLKRG SITPQEENTI QELHALWGNR WSAIARSLPG RTDNEIKNYW RTHFKKDNTP  120
RKKAERARAR LLVRQQQERQ KHKQQQQEAE DMGGTSTMKQ VEEDAMRAEE VQEMAYVLQG  180
GGFQGYMSDE DGSWGCLWNL DDDDDASEYT EGGSTSQQVS SSTNISFFIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26161167106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384058.11e-161PREDICTED: transcription factor MYB114-like
TrEMBLM0RSZ91e-171M0RSZ9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P17190_0011e-171(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-62myb domain protein 79